Radl1_arath protein radialis-like 1

Author: fdli

August undefined, 2024

WebMyb family transcription factor family protein: Location: LG10 : 17560319 .. 17562588 (-) Sequence length: 497: Sequences. The following sequences are available for this feature: Gene sequence (with intron) Legend: exon polypeptide CDS. Hold the cursor over a type above to highlight its positions in the sequence below. ...

A Small Subfamily of Arabidopsis RADIALIS-LIKE SANT/MYB …

WebDec 19, 2024 · RADIALIS-LIKE SANT/MYB 1 (RSM1) belongs to a MYB-related subfamily, and previous transcriptome analysis suggests that RSM1 may play roles in plant … WebSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44 W+ E ++ +a +++ + +W+++a+ +g g+t+ ... dwd international

Transcriptome and metabolome profiling unveiled mechanisms of …

WebRADL1 – Resampled Radar Map at Level 1. For more information about RTLS-GBT RADL1 products, see the Data Set Catalog File and “ Focused 70-cm Wavelength Radar Mapping … WebBLAST of Csa1G021940 vs. Swiss-Prot Match: RADL1_ARATH(Protein RADIALIS-like 1 OS=Arabidopsis thaliana GN=RL1 PE=2 SV=1) HSP 1Score: 70.1 bits (170), Expect = 4.8e-11 Identity = 31/81 (38.27%), Postives = 48/81 (59.26%), Query Frame = 1 Query: 2 STGSAVWTKEEDKAFENAIATHWGEELEGSKGSEEMWEKIASMVPSKNMEDLKQHYQMLV 61 WebAug 23, 2007 · To select OsWRKY genes that might function in induced defense responses in rice, we constructed a phylogenetic tree with 184 WRKY proteins, including 72 from Arabidopsis, 105 from rice, and 7 from other species ( Fig. 1a ). crystal gardiner

Fraxinus_pennsylvanica_120313_comp48921_c0_seq5 HWG

F4JVB8 SWISS-MODEL Repository

WebMar 1, 2003 · Q8GW75 · RADL5_ARATH. Protein. Protein RADIALIS-like 5. Gene. RL5. Status. UniProtKB reviewed (Swiss-Prot) Organism. Arabidopsis thaliana (Mouse-ear cress) Amino acids. 100. Protein existence. ... PTHR43952:SF95 PROTEIN RADIALIS-LIKE 5 1 hit; SMART. View protein in SMART; SM00717 SANT 1 hit; SUPFAM. WebLotus japonicus genome version. Gifu v1.2. Description. Transcription factor RADIALIS; TAIR: AT1G75250.1 RAD-like 6; Swiss-Prot: sp F4JVB8 RADL1_ARATH Protein RADIALIS … crystal garden victoria historyWebDec 1, 2024 · ultra-performance liquid chromatography - tandem mass spectrometer 1. Introduction Tea ( Camellia sinensis (L.) Kuntze, Theaceae) is an important economic … crystal garden wedding

"WebProtein RADIALIS-like 6 OS=Arabidopsis thaliana OX=3702 GN=RL6 PE=2 SV=1: sp F4JVB8 RADL1_ARATH: 6.6e-18: 49.38: Protein RADIALIS-like 1 OS=Arabidopsis … " - Radl1_arath protein radialis-like 1

Radl1_arath protein radialis-like 1

WebBLAST of Acc04629.1 vs. NCBI nr Match: XP_022026250.1 (protein RADIALIS-like 3 [Helianthus annuus] >XP_022024773.1 protein RADIALIS-like 3 [Helianthus annuus] >OTF84339.1 putative WebJul 16, 2013 · PM-localized Ca 2+ /CaM-regulated receptor-like kinase 1 (CRLK1), a serine/threonine kinase, in Arabidopsis is reported to be involved in cold-stress response and activated by Ca 2+ /CaM [26]....

Did you know?

WebConsolidated transcript/protein view: LotjaGi5g1v0015800.1 is a Transcription factor RADIALIS; TAIR: AT1G75250.1 RAD-like 6; Swiss-Prot: sp F4JVB8 RADL1_ARATH Protein RADIALIS-like 1; TrEMBL-Plants: tr A0A072VEW4 A0A072VEW4_MEDTR MYB family transcription factor; Found in the gene: LotjaGi5g1v0015800 WebCmoCh09G001560.1: Type: mRNA: Organism: Cucurbita moschata (Cucurbita moschata (Rifu)) Description (DNA binding protein) (MYB-related transcription factor) Location: Cmo_Chr09 : 692418 .. 693029 (-) Sequence length: 520: Genome Viewer Sequences The following sequences are available for this feature: Gene sequence (with intron) Legend ...

WebApr 6, 2024 · The full genome sequencing and resequencing of multiple pear cultivars ( Huang et al., 2015; Li, Xu & Huang, 2016; Wang et al., 2024; Wu et al., 2013) have enabled … WebJul 11, 2006 · Disclaimer. Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way …

WebAug 18, 2024 · Fraxinus_pennsylvanica_120313_comp61555_c0_seq7 . Summary . Annotations WebF4JVB8 - RADL1_ARATH. Gene RL1 Modification Unmodified Mutation Wild type View Product On Supplier's Website Request a Quote from Cusabio. Add to Procurement List ... Protein RADIALIS-like 1, Protein RADIALIS-LIKE SANT/MYB 2, RADL1_ARATH. UniProt Code History F4JVB8, Q0NZY1, Q9T032.

http://cucurbitgenomics.org/feature/mRNA/CmoCh09G001560.1

WebA rabbit polyclonal antibody, raised against Protein RADIALIS-like 1, supplied by Cusabio. dw discount ticketsWebRL1 protein (Arabidopsis thaliana) - STRING interaction network Nodes: Network nodes represent proteins splice isoforms or post-translational modifications are collapsed, i.e. each node represents all the proteins produced by a single, protein-coding gene locus. Node Color colored nodes: query proteins and first shell of interactors white nodes: dwdisplayWebScore. RL1. Radialis-like sant/myb 2; Protein RADIALIS-like 1; Probable transcription factor (100 aa) Predicted Functional Partners: AT4G16660. Heat shock protein 70 (Hsp 70) … dwd issuanceWebIn this study, a small subfamily of single-MYB transcription factor genes, designated RSM1, RSM2, RSM3 and RSM4 (RADIALIS-LIKE SANT/MYB 1-4), was characterized. Here, we … dw distribution doorsWebJul 11, 2006 · Q1A173 · RADL6_ARATH. Protein. Protein RADIALIS-like 6. Gene. RL6. Status. UniProtKB reviewed (Swiss-Prot) Organism. Arabidopsis thaliana (Mouse-ear cress) Amino acids. 97. Protein existence. ... PTHR43952:SF93 PROTEIN RADIALIS-LIKE 6 1 hit; SMART. View protein in SMART; SM00717 SANT 1 hit; SUPFAM. crystal garden walmerWebPlant transcription factor database, a portal for the functional and evolutionary study of plant transcription factors crystal garden windowWeb1 State Key Laboratory of Plant Genomics, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China. d w distributors